PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.2G239700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family bZIP
Protein Properties Length: 356aa    MW: 38042.1 Da    PI: 9.8818
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.2G239700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_142.71.2e-13276326555
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 
                         +r rr++kNRe+A rsR+RK+a++ eLe +v++L++ N++L  +  e+ ++
  Sevir.2G239700.1.p 276 RRHRRMIKNRESAARSRARKQAYTMELEAEVQKLKELNQELERKQAEIMEM 326
                         699************************************998877777666 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1708.9E-14271335No hitNo description
SMARTSM003386.2E-11272337IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.645274325IPR004827Basic-leucine zipper domain
CDDcd147071.86E-23276328No hitNo description
SuperFamilySSF579593.06E-10276324No hitNo description
PfamPF001707.8E-12276327IPR004827Basic-leucine zipper domain
PROSITE patternPS000360279294IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 356 aa     Download sequence    Send to blast
MEFKNGGSSS QRRPAVEEGA PLARQGSVYS LTFDEFQSAL GGAAGGGGGG IGRDFGSMNM  60
DELLRNIWNA EETQAMASAS GAGAQPAPLQ RQGSSLTLPR TLSSKTVDEV WRNLVRDEPP  120
QGVDGGGQQQ AHRQSTLGEM TLEEFLVRAG VVRENPAPAA APAPPPMLPP RPVPVAPKST  180
AFLGNFPGAD DAAAAVALGF APIGMGDPAL GNGLMPPRAA GMGGSAMAVQ TAVNQLDSGG  240
KGYSDLLSPT EPLPYSFEGM IRGRRNGGGV EKVVERRHRR MIKNRESAAR SRARKQAYTM  300
ELEAEVQKLK ELNQELERKQ AEIMEMQKNE LPEMLKDPFR RKKRVCLRRT LTGPW*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004957010.10.0PREDICTED: bZIP transcription factor TRAB1-like
SwissprotQ6ZDF31e-105TRAB1_ORYSJ; bZIP transcription factor TRAB1
TrEMBLK3ZUL90.0K3ZUL9_SETIT; Uncharacterized protein
STRINGSi030114m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP70638147
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G19290.11e-40ABRE binding factor 4